PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA031300-PA
Common NameOsI_32458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BES1
Protein Properties Length: 651aa    MW: 73343.7 Da    PI: 5.4434
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA031300-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822125.19.1e-3946120377
            DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskple 77 
                       ++r +  +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+neV++AL+reAGwvv +DGtt++ +s+  +
  BGIOSGA031300-PA  46 GRRGRAREEKERTKLRERQRRAITARILAGLRRHGNYNLRVRADINEVIAALAREAGWVVLPDGTTFPSSSSSVS 120
                       57888899************************************************************7776652 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.7E-3747174IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514451.55E-187208647IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.4E-205211645IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.3E-114217635IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77248262IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77269287IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77291312IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060295303IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008421.2E-8374383IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007507.5E-77384406IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77457476IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77491507IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77508519IPR001554Glycoside hydrolase, family 14
PRINTSPR007507.5E-77526549IPR001554Glycoside hydrolase, family 14
PRINTSPR008421.2E-8529539IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007507.5E-77566588IPR001554Glycoside hydrolase, family 14
PRINTSPR008421.2E-8617631IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008421.2E-8632646IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MQQQQQAMEE DGVKEEEEEY YLEEEDEGEE ETRPPLQQQQ QQVGLGRRGR AREEKERTKL  60
RERQRRAITA RILAGLRRHG NYNLRVRADI NEVIAALARE AGWVVLPDGT TFPSSSSSVS  120
QPPPTQQQLQ PGRPSIAAPP LPSSPAPPLR GISISPVAAR PISSLRSSSS IRIISPPHAL  180
PDPLLSLPSM DPQEVPDLLP PRPPERDFAG TPYVPVYVML PLGVVNGNGE VVDADVLVGQ  240
LRVLKAAGVD GVMVDCWWGN VEAHRPQEYN WTGYKRLFHM IRELKLKLQV VMSFHECGGN  300
VGDDVSIPLP HWVTEIGRSN PDIYFTDRAG RRNTECLSWG IDKERVLQGR TGVEVYFDYM  360
RSFRVEFDEY FEDGIISEIE IGLGACGELR YPSYPAKHGW KYPGIGEFQC YDRYLQKSLR  420
RAAEARGHTI WARAPDSAGH YNSEPNLTGF FSDGGDYDSY YGRFFLNWYS QVLVDHADRV  480
LMLARLAFEG SDIAVKVSGV HWWYKTASHA AELTAGFYNP CNRDGYASIA AVLKKHGAAL  540
NFTCVELRTM DQHEVFPEAF ADPEGLVWQV LNAAWDAGIP VASENALPCY DRDGFNKILE  600
NAKPLNDPDG RHLLGFTYLR LTKVLFERAN FLEFERFVKR MHGEAVLDLQ V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bfn_A1e-15921364411444BETA-AMYLASE
1btc_A1e-1592136447440BETA-AMYLASE
1bya_A1e-15921364411444BETA-AMYLASE
1byb_A1e-15921364411444BETA-AMYLASE
1byc_A1e-15921364411444BETA-AMYLASE
1byd_A1e-15921364411444BETA-AMYLASE
1q6c_A1e-15921364411444beta-amylase
1wdp_A1e-15921364411444Beta-amylase
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.56400.0callus| flower| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329803240.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703000.0AK070300.1 Oryza sativa Japonica Group cDNA clone:J023048N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611670.10.0PREDICTED: beta-amylase 2, chloroplastic isoform X1
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLB8BEN80.0B8BEN8_ORYSI; Beta-amylase
STRINGBGIOSGA031300-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7